DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and SC35

DIOPT Version :10

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_201225.1 Gene:SC35 / 836541 AraportID:AT5G64200 Length:303 Species:Arabidopsis thaliana


Alignment Length:187 Identity:65/187 - (34%)
Similarity:91/187 - (48%) Gaps:28/187 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 VFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSGIEVDG 165
            |..:...|:...:..||.|||.:..:.:..|.:|..||||.|:.::...:|..|.:...|..|||
plant    20 VLNITFRTTADDLYPLFAKYGKVVDVFIPRDRRTGDSRGFAFVRYKYKDEAHKAVERLDGRVVDG 84

  Fly   166 RRIRVDFS--------ITQ-RAHTPTPGVYLGRQPRGKAP-RSFSPRRG----RRVYHDRSASP- 215
            |.|.|.|:        |:: |...|.|   ..|:.|.::| ||.||||.    ||....||.|| 
plant    85 REITVQFAKYGPNAEKISKGRVVEPPP---KSRRSRSRSPRRSRSPRRSRSPPRRRSPRRSRSPR 146

  Fly   216 ---YDNYRDRYDY----RNDRYDRNLRRSPSRNRYTRNRSYSRSRSP-QLRRTSSRY 264
               .|:||:: ||    |:..|||. .|...::|..|.|:.|||.|| :.||...||
plant   147 RRSRDDYREK-DYRKRSRSRSYDRR-ERHEEKDRDHRRRTRSRSASPDEKRRVRGRY 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM_TRA2 96..175 CDD:409798 24/81 (30%)
SC35NP_201225.1 RRM_SRSF2_SRSF8 18..90 CDD:409751 22/69 (32%)
PHA03307 <204..>303 CDD:223039
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.