DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and AT5G55550

DIOPT Version :10

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001331843.1 Gene:AT5G55550 / 835649 AraportID:AT5G55550 Length:507 Species:Arabidopsis thaliana


Alignment Length:241 Identity:59/241 - (24%)
Similarity:86/241 - (35%) Gaps:60/241 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 ESPPPEPRHRSGRSSRDRERMH-KSREHPQASRCIGVF--GLNTNTSQHKVRELFNKYGPIERIQ 127
            |:....||.......|....:| .|..|....|...:|  ||.::.::.:.:..|:::|.|..:.
plant   123 EAKKAVPRDDQQVLKRHASPIHLMSPVHGGGGRTKKIFVGGLPSSITEEEFKNYFDQFGTIADVV 187

  Fly   128 MVIDAQTQRSRGFCFIYFE------------------KLSDARAA------------KDSCSGIE 162
            ::.|..|||.|||.||.|:                  ||.:.:.|            ....||:.
plant   188 VMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELNGKLVEVKRAVPKEISPVSNIRSPLASGVN 252

  Fly   163 VDGRRIRVDFSITQRAHTPTPGVYLGRQPRGKAPRSFSP--RRGRR--------VYHDRSASPYD 217
            ..|...|:..:.......|.||.|....|.|   |.|||  ..||.        :.||.|.    
plant   253 YGGGSNRMPANSYFNNFAPGPGFYNSLGPVG---RRFSPVIGSGRNAVSAFGLGLNHDLSL---- 310

  Fly   218 NYRDRYDYRNDRYDRNLRRSPSR--------NRYTRNRSYSRSRSP 255
            |.....|..:..:..|  |.||.        ||||....::|:.||
plant   311 NLNPSCDGTSSTFGYN--RIPSNPYFNGASPNRYTSPIGHNRTESP 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM_TRA2 96..175 CDD:409798 24/110 (22%)
AT5G55550NP_001331843.1 RRM1_hnRNPA_hnRNPD_like 8..75 CDD:409763
ELAV_HUD_SF 19..>329 CDD:273741 50/214 (23%)
RRM2_Hrp1p 158..235 CDD:409767 19/76 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.