DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and AT4G35785

DIOPT Version :9

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_974690.4 Gene:AT4G35785 / 829732 AraportID:AT4G35785 Length:239 Species:Arabidopsis thaliana


Alignment Length:225 Identity:82/225 - (36%)
Similarity:109/225 - (48%) Gaps:23/225 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 SRRHQRSSSRRRSRSRSSSESPPPEPRHRSGRSSRDRERMHKSREHPQASRCIGVFGLNTNTSQH 111
            ||...||.||.|.||||.|...|..|....|| ||.|.|.....|:|..:  :.|.||:|..:..
plant    25 SRSRSRSRSRPRLRSRSRSLPRPVSPSRSRGR-SRSRSRGRSEVENPGTT--LYVTGLSTRVTDK 86

  Fly   112 KVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSGIEVDGRRIRVDFSITQ 176
            .:...|.|.|.:....:|::.:|:.||||.|:....|.||.......:...::||.|.|:.|..:
plant    87 DLEAHFAKEGKVASCFLVMEPRTRVSRGFAFVTMSSLKDAERCIKYLNQSVLEGRYITVERSRRK 151

  Fly   177 RAHTPTPGVYLGRQPRGKAPRSFSPRRGRRVYHDRSASPYDNYRDRYDYRNDRYDRNLRRSPSRN 241
            |..|||||.|||.:....:.|.....|||  ::||     |:||||...|.|...|:.|||    
plant   152 RPRTPTPGHYLGLKSSRDSDREGRSSRGR--HYDR-----DDYRDRRSPRRDYSPRDERRS---- 205

  Fly   242 RYTRNRSYS-RSRSPQLR------RTSSRY 264
              .|:|||| ..|||:.|      |:..||
plant   206 --RRDRSYSPHGRSPERRSERRSERSERRY 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM <74..242 CDD:223796 56/167 (34%)
RRM_TRA2 98..175 CDD:240809 22/76 (29%)
AT4G35785NP_974690.4 RRM 73..145 CDD:214636 20/73 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 101 1.000 Inparanoid score I2169
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001901
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR48034
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.