DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and AT4G20030

DIOPT Version :10

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_567594.1 Gene:AT4G20030 / 827748 AraportID:AT4G20030 Length:152 Species:Arabidopsis thaliana


Alignment Length:130 Identity:35/130 - (26%)
Similarity:62/130 - (47%) Gaps:16/130 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 PRHRSGRSSRDRERMHKSREHPQASRCIGVFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQR 136
            |.:|:.|..:.:..:.   .:|.||: |.|..|..:||:..::..|:.:|.|..::::.|...:|
plant    19 PNYRNLRFPKIKASLF---NYPLASK-IMVRNLPFSTSEDFLKREFSAFGEIAEVKLIKDEAMKR 79

  Fly   137 SRGFCFIYFEKLSDARAAKDSCSGIEVDGRRIRVDFSITQRAHTPTPGVYLGRQPRGKAPRSFSP 201
            |:|:.||.|....||..|.::......:||.|.:|.:        .||   .|..:| .||:..|
plant    80 SKGYAFIQFTSQDDAFLAIETMDRRMYNGRMIYIDIA--------KPG---KRDFQG-LPRTSGP 132

  Fly   202  201
            plant   133  132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM_TRA2 96..175 CDD:409798 23/78 (29%)
AT4G20030NP_567594.1 RRM 41..113 CDD:214636 21/72 (29%)

Return to query results.
Submit another query.