DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and RSZ22a

DIOPT Version :10

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_180035.1 Gene:RSZ22a / 816995 AraportID:AT2G24590 Length:196 Species:Arabidopsis thaliana


Alignment Length:191 Identity:52/191 - (27%)
Similarity:74/191 - (38%) Gaps:41/191 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 VFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSGIEVDG 165
            |..|:...::.::.:.|..:|.|..:.:     .:|..|:.|:.||   |:|.|:|:..  ||||
plant     6 VGNLDPRVTERELEDEFRSFGVIRSVWV-----ARRPPGYAFLDFE---DSRDARDAIR--EVDG 60

  Fly   166 RR-IRVDFSITQRAHTPTPGVYLGR------QPRG----------------KAPRSFSPRRGRRV 207
            :. .||:.|..:.......|   ||      :.||                :..||.....|||.
plant    61 KNGWRVEQSHNRGGGGGRGG---GRGGGDGGRGRGGSDLKCYECGESGHFARECRSRGGSGGRRR 122

  Fly   208 YHDRSASPYDNYRDRYDYRNDR-YDRNLRRSPSRNRYT---RNRSYSRSRSPQLRRTSSRY 264
            ...||.|| ..||....|...| |....|..|...|.:   |.|:||||..|...|....|
plant   123 SRSRSRSP-PRYRKSPTYGGRRSYSPRARSPPPPRRRSPSPRGRNYSRSPPPYRARDEVPY 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM_TRA2 96..175 CDD:409798 21/74 (28%)
RSZ22aNP_180035.1 RRM_SRSF3_like 3..71 CDD:409808 21/74 (28%)
zf-CCHC 97..111 CDD:395050 0/13 (0%)

Return to query results.
Submit another query.