DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and hnrnpa3

DIOPT Version :9

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001315077.1 Gene:hnrnpa3 / 751729 ZFINID:ZDB-GENE-060224-1 Length:340 Species:Danio rerio


Alignment Length:143 Identity:39/143 - (27%)
Similarity:59/143 - (41%) Gaps:34/143 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 RSSSRRRSRS------RSSSE---SPPPEPRHRSGR-----SSRDRERMHKSREHPQASRCIGVF 102
            |..:.:|||.      .|.||   :....|....||     .:..||..:|...|....: |.|.
Zfish    46 RDPANKRSRGFGFVTYSSVSEVDAAMTARPHKVDGRVVEPKRAVSREDSNKPGAHLTVKK-IFVG 109

  Fly   103 GLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSGIEVDGRR 167
            |:..:|.::.:||.|..||.||.|.::.:..|.:.|||||:.|:.       .|:          
Zfish   110 GIKEDTEEYHIREYFECYGKIETIDIMEERSTGKKRGFCFVTFDD-------HDT---------- 157

  Fly   168 IRVDFSITQRAHT 180
              ||..:.|:.||
Zfish   158 --VDKIVAQKYHT 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM <74..242 CDD:223796 31/112 (28%)
RRM_TRA2 98..175 CDD:240809 22/76 (29%)
hnrnpa3NP_001315077.1 RRM1_hnRNPA_like 14..91 CDD:241022 10/44 (23%)
RRM2_hnRNPA3 104..183 CDD:241026 25/85 (29%)
HnRNPA1 <296..>315 CDD:288479
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.