DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and cirbpb

DIOPT Version :9

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001035411.2 Gene:cirbpb / 678563 ZFINID:ZDB-GENE-030131-5841 Length:206 Species:Danio rerio


Alignment Length:183 Identity:56/183 - (30%)
Similarity:78/183 - (42%) Gaps:54/183 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 GLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSGIEVDGRR 167
            ||:.:|::..:.|.|:|||.|.::.::.|.:|.|||||.|:.||...||:.|..:.:|.:||||.
Zfish    11 GLSYDTTEQSLEEAFSKYGTIAKVDVIRDRETDRSRGFGFVTFENPEDAKDAMAAMNGKQVDGRM 75

  Fly   168 IRVD-----------FSITQRAHTPTPGVYLGRQPRG----------KAPRSFSPRR-------- 203
            ||||           |....|.  ...|.:.|.:.||          .:.|||...|        
Zfish    76 IRVDEAGKSGGRSGGFRGGSRG--GGRGFFRGSRGRGGGGYGGDRSYGSDRSFGGDRSYGGDRSY 138

  Fly   204 ---------GRRVY--HDRS----ASPYDNYRDRYD----YRNDR----YDRN 233
                     |.|.|  .|||    ...|.|....|.    ||::|    |||:
Zfish   139 GGGDRGYGGGERSYGGGDRSYGGGGGGYSNRSGGYSSGGGYRDNRNQGGYDRS 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM <74..242 CDD:223796 56/183 (31%)
RRM_TRA2 98..175 CDD:240809 32/82 (39%)
cirbpbNP_001035411.2 RRM <2..>81 CDD:223796 31/69 (45%)
RRM_SF 5..83 CDD:302621 31/71 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48034
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.