DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and TRA2B

DIOPT Version :9

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_004584.1 Gene:TRA2B / 6434 HGNCID:10781 Length:288 Species:Homo sapiens


Alignment Length:294 Identity:120/294 - (40%)
Similarity:156/294 - (53%) Gaps:57/294 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DREPLSSGR-----------LHCSARYKHK---RSASSSSAGTTSSGHKDRRSDYDYCGSRRH-- 50
            :||..|:.|           .|..||.:.|   |.:.|.|...:.|..:.|||      ||||  
Human    11 ERESRSASRSGSAHGSGKSARHTPARSRSKEDSRRSRSKSRSRSESRSRSRRS------SRRHYT 69

  Fly    51 -QRSSSRRRSRSRSSSESPPPEPRHRSGRSSRDRERMH-KSREHPQASRCIGVFGLNTNTSQHKV 113
             .||.||...||||.|.|.....||....|.....|.| .:|.:|..:.|:|||||:..|::..:
Human    70 RSRSRSRSHRRSRSRSYSRDYRRRHSHSHSPMSTRRRHVGNRANPDPNCCLGVFGLSLYTTERDL 134

  Fly   114 RELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSGIEVDGRRIRVDFSITQRA 178
            ||:|:|||||..:.:|.|.|::|||||.|:|||.:.||:.||:..:|:|:||||||||||||:|.
Human   135 REVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRP 199

  Fly   179 HTPTPGVYLGRQPRGKAPRSFSPRRGRRVYHDRSASPYDNYRDRYDYRNDRY------------- 230
            ||||||:|:||...|.:        .||.|:||.   ||...|..||.:..|             
Human   200 HTPTPGIYMGRPTYGSS--------RRRDYYDRG---YDRGYDDRDYYSRSYRGGGGGGGGWRAA 253

  Fly   231 -DRN---LRRSP----SRNRYTRNRSYSRSRSPQ 256
             ||:   .||||    ||..| |:||.|||.||:
Human   254 QDRDQIYRRRSPSPYYSRGGY-RSRSRSRSYSPR 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM <74..242 CDD:223796 81/189 (43%)
RRM_TRA2 98..175 CDD:240809 43/76 (57%)
TRA2BNP_004584.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..114 35/108 (32%)
RRM_TRA2 117..196 CDD:409798 43/78 (55%)
Linker 193..230 22/47 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 196..225 16/36 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..288 17/46 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 85 1.000 Domainoid score I8169
eggNOG 1 0.900 - - E33208_3BKR9
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 176 1.000 Inparanoid score I4049
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001901
OrthoInspector 1 1.000 - - otm41356
orthoMCL 1 0.900 - - OOG6_103481
Panther 1 1.100 - - O PTHR48034
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1765
SonicParanoid 1 1.000 - - X1620
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.850

Return to query results.
Submit another query.