DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and SAFB

DIOPT Version :9

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001188267.1 Gene:SAFB / 6294 HGNCID:10520 Length:917 Species:Homo sapiens


Alignment Length:225 Identity:50/225 - (22%)
Similarity:92/225 - (40%) Gaps:24/225 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RRSDYDYCGSRRHQRSSSRRRSRSRSSSESPPPEPRHRSGRSSRDRERMHKSREHPQASRC---I 99
            |:.|:|.|         :......:.||.|...:.:..|.....|.:|:  |:|....|.|   .
Human   355 RKFDFDAC---------NEVPPAPKESSTSEGADQKMSSPEDDSDTKRL--SKEEKGRSSCGRNF 408

  Fly   100 GVFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSGIEVD 164
            .|.||::.|....::.||:|||.:...::|.:|::..:|.:.|:......:|....:.....|:.
Human   409 WVSGLSSTTRATDLKNLFSKYGKVVGAKVVTNARSPGARCYGFVTMSTAEEATKCINHLHKTELH 473

  Fly   165 GRRIRVDFSITQRAHTPTPGVYLGRQPRGKAPRSFSPRRGRRVYHDRSASPYDNYRDRYD----Y 225
            |:.|.|:.:..:.....|..   .|...||..:|.:..|...:..|......|:.:...|    .
Human   474 GKMISVEKAKNEPVGKKTSD---KRDSDGKKEKSSNSDRSTNLKRDDKCDRKDDAKKGDDGSGEK 535

  Fly   226 RNDRYDRNLRRSPS-RNRYTRNRSYSRSRS 254
            ..|:.|:  :..|| |:|.|::.|....|:
Human   536 SKDQDDQ--KPGPSERSRATKSGSRGTERT 563

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM <74..242 CDD:223796 39/175 (22%)
RRM_TRA2 98..175 CDD:240809 19/79 (24%)
SAFBNP_001188267.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33
SAP 31..65 CDD:128789
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 64..118
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..407 14/62 (23%)
RRM_SAFB1_SAFB2 405..480 CDD:241123 17/74 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 477..641 20/92 (22%)
Interaction with POLR2A. Interaction with SFRS1, SFRS9 and SFRS10. /evidence=ECO:0000250|UniProtKB:O88453, ECO:0000269|PubMed:9671816 528..792 10/38 (26%)
Nuclear localization signal. /evidence=ECO:0000255 599..616
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 671..708
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1765
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.