DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and hnrnpd

DIOPT Version :9

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001103930.1 Gene:hnrnpd / 560522 ZFINID:ZDB-GENE-070424-97 Length:314 Species:Danio rerio


Alignment Length:203 Identity:48/203 - (23%)
Similarity:85/203 - (41%) Gaps:43/203 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 ERMHKSREH--------PQASRC---------IGVFGLNTNTSQHKVRELFNKYGPIERIQMVID 131
            |::...:||        |:.::.         |.|.||:.:|.:.|:||.|:.||.:|.|::.::
Zfish   109 EKVITQKEHKLNGKVIDPKKAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFDAYGEVESIELPME 173

  Fly   132 AQTQRSRGFCFIYFEKLSDARAAKDSC-SGIEVDGRRIRVDFS---ITQRAHTPTPGVYLGR-QP 191
            .:|.:.||||||.|::....:...:.. ..|.:....::|..|   ..|:......|.|..| :.
Zfish   174 NKTNKRRGFCFITFKEEEPVKKIMEKMYHNIGLSKCEVKVAMSKEQYQQQQQWGGRGGYTSRGRG 238

  Fly   192 RGKAPRSFSP-------------------RRGRRVYHDRSASPYDNYRDRYDYRNDR--YDRNLR 235
            ||...::::.                   .:|...|.....|.|:||....||.|.:  |.::.|
Zfish   239 RGGPNQNWNQGYGNYWNQGYGNYGNYGYNNQGYGGYGGYDYSGYNNYYGYGDYSNQQSGYGKSQR 303

  Fly   236 RSPSRNRY 243
            |...:|.|
Zfish   304 RGGHQNSY 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM <74..242 CDD:223796 46/200 (23%)
RRM_TRA2 98..175 CDD:240809 24/89 (27%)
hnrnpdNP_001103930.1 CBFNT 3..54 CDD:285369
RRM1_hnRNPD_like 56..129 CDD:241019 4/19 (21%)
RRM2_hnRNPD 140..214 CDD:241027 22/73 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.