DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and cirbpa

DIOPT Version :9

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001017797.1 Gene:cirbpa / 550495 ZFINID:ZDB-GENE-050417-329 Length:185 Species:Danio rerio


Alignment Length:183 Identity:49/183 - (26%)
Similarity:67/183 - (36%) Gaps:68/183 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 GLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSGIEVDGRR 167
            ||:.:|::..:.:.|:|||.|..:.:..:.:|.|||||.|:.||...||:.|.:..:|..||||.
Zfish    11 GLSFDTTEQSLEDAFSKYGVITNVHVARNRETNRSRGFGFVTFENPDDAKDALEGMNGKSVDGRT 75

  Fly   168 IRVDFSITQRAHTPTPGVYLGRQPRGKAPRS-------------------FSPRRGR-------- 205
            ||||.:              |:...|...||                   |...|||        
Zfish    76 IRVDEA--------------GKGGGGGGGRSGGGGSYRGGGGGRGGGGGFFRGGRGRGGGGGGYG 126

  Fly   206 ---RVYHDRS-------------------ASPYD-----NYRDRYDYRNDRYD 231
               |.|.|||                   ...|:     .|.||.....|.||
Zfish   127 GGDRSYGDRSYGGGGGGYKSGGGGYSSGGGGGYNRDRGSGYGDRSSSYKDGYD 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM <74..242 CDD:223796 49/183 (27%)
RRM_TRA2 98..175 CDD:240809 29/71 (41%)
cirbpaNP_001017797.1 RRM <2..>81 CDD:223796 29/69 (42%)
RRM_SF 5..83 CDD:302621 29/85 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48034
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.