DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and safb

DIOPT Version :9

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001016713.1 Gene:safb / 549467 XenbaseID:XB-GENE-5873119 Length:135 Species:Xenopus tropicalis


Alignment Length:58 Identity:14/58 - (24%)
Similarity:21/58 - (36%) Gaps:15/58 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 SSESPPPEPRHRSGR---------------SSRDRERMHKSREHPQASRCIGVFGLNT 106
            ||::|..:...||||               |..::|......|...|.:|..:..|.|
 Frog    70 SSDTPSKKTPKRSGRVRKIEEGEDNGLEDDSGDNQENEDPGTEQGTALQCSNMVALIT 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM <74..242 CDD:223796 11/48 (23%)
RRM_TRA2 98..175 CDD:240809 3/9 (33%)
safbNP_001016713.1 SAP 23..57 CDD:128789
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1765
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.