powered by:
Protein Alignment tra2 and safb
DIOPT Version :9
Sequence 1: | NP_476764.1 |
Gene: | tra2 / 36619 |
FlyBaseID: | FBgn0003742 |
Length: | 264 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001016713.1 |
Gene: | safb / 549467 |
XenbaseID: | XB-GENE-5873119 |
Length: | 135 |
Species: | Xenopus tropicalis |
Alignment Length: | 58 |
Identity: | 14/58 - (24%) |
Similarity: | 21/58 - (36%) |
Gaps: | 15/58 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 64 SSESPPPEPRHRSGR---------------SSRDRERMHKSREHPQASRCIGVFGLNT 106
||::|..:...|||| |..::|......|...|.:|..:..|.|
Frog 70 SSDTPSKKTPKRSGRVRKIEEGEDNGLEDDSGDNQENEDPGTEQGTALQCSNMVALIT 127
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
tra2 | NP_476764.1 |
RRM |
<74..242 |
CDD:223796 |
11/48 (23%) |
RRM_TRA2 |
98..175 |
CDD:240809 |
3/9 (33%) |
safb | NP_001016713.1 |
SAP |
23..57 |
CDD:128789 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R1765 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.030 |
|
Return to query results.
Submit another query.