DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and Tra2a

DIOPT Version :9

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001119768.2 Gene:Tra2a / 500116 RGDID:1562563 Length:282 Species:Rattus norvegicus


Alignment Length:258 Identity:112/258 - (43%)
Similarity:148/258 - (57%) Gaps:32/258 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ARYKHKRSASSSSAGTTSSGHKDRRSDYDYCGSRRHQRSSSRRRSRSRSSSESPPPEPRHRSGRS 79
            :::....|.|.|.:.:.|..|..||    |..||.|   |.||||||||.:    ||.|.|..||
  Rat    43 SKHSESHSRSRSKSRSRSRRHSHRR----YTRSRSH---SHRRRSRSRSYT----PEYRRRRSRS 96

  Fly    80 ---SRDRERMHKSREHPQASRCIGVFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFC 141
               ..:|.|...||.:|..:.|:|||||:..|::..:||:|::|||:..:.:|.|.:|.|||||.
  Rat    97 HSPMSNRRRHTGSRANPDPNTCLGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFA 161

  Fly   142 FIYFEKLSDARAAKDSCSGIEVDGRRIRVDFSITQRAHTPTPGVYLGRQPR---------GKAPR 197
            |:|||::.|::.|.:..:|:|:||||||||:|||:||||||||:|:||...         |....
  Rat   162 FVYFERIDDSKEAMERANGMELDGRRIRVDYSITKRAHTPTPGIYMGRPTHSGGGGGGGGGGGGG 226

  Fly   198 SFSPRRGRRVYHDRSAS-PYDNYRDRYDYRNDRYDRNLRRSPSRNRYTRNRSYSRSRSPQLRR 259
            .....|.|..|:||... .||.|.| |||      |..||||| ..|:|.||.|||||...||
  Rat   227 GGGGGRRRDSYYDRGYDRGYDRYED-YDY------RYRRRSPS-PYYSRYRSRSRSRSYSPRR 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM <74..242 CDD:223796 78/180 (43%)
RRM_TRA2 98..175 CDD:240809 38/76 (50%)
Tra2aNP_001119768.2 RRM_TRA2 116..195 CDD:409798 38/78 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345868
Domainoid 1 1.000 85 1.000 Domainoid score I7985
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 174 1.000 Inparanoid score I3976
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001901
OrthoInspector 1 1.000 - - otm45481
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR48034
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1620
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.950

Return to query results.
Submit another query.