DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and NCL

DIOPT Version :9

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_005372.2 Gene:NCL / 4691 HGNCID:7667 Length:710 Species:Homo sapiens


Alignment Length:189 Identity:43/189 - (22%)
Similarity:80/189 - (42%) Gaps:44/189 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 KHKRSASSSSAGTTSSGHKDRRSDYDYCGSRRHQRSSSRRRSRSRSSSESPPPEPRHRSGRSSRD 82
            :::...|...|....:..:|.:...:.|..|..:..:      .|...:.|...|..||      
Human   516 QNQNGKSKGYAFIEFASFEDAKEALNSCNKREIEGRA------IRLELQGPRGSPNARS------ 568

  Fly    83 RERMHKSREHPQASRCIGVFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEK 147
                       |.|:.:.|.||:.:|::..::|.|:  |.: |.::|.|.:|..|:||.|:.|..
Human   569 -----------QPSKTLFVKGLSEDTTEETLKESFD--GSV-RARIVTDRETGSSKGFGFVDFNS 619

  Fly   148 LSDARAAKDSCSGIEVDGRRIRVDFSITQRAHTPTPGVYLGRQPRGKAPRSFSPRRGRR 206
            ..||:|||::....|:||.::.:|::                :|:|:.  .|..|.|.|
Human   620 EEDAKAAKEAMEDGEIDGNKVTLDWA----------------KPKGEG--GFGGRGGGR 660

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM <74..242 CDD:223796 35/133 (26%)
RRM_TRA2 98..175 CDD:240809 25/76 (33%)
NCLNP_005372.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..303
8 X 8 AA tandem repeats of X-T-P-X-K-K-X-X 58..135
RRM1_NCL 307..381 CDD:240849
RRM 379..628 CDD:223796 32/137 (23%)
RRM2_NCL 390..465 CDD:240850
RRM3_NCL 485..557 CDD:240851 6/46 (13%)
RRM4_NCL 572..649 CDD:240852 26/95 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 640..710 7/39 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48034
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.