DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and rbm34

DIOPT Version :10

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001004890.1 Gene:rbm34 / 448232 XenbaseID:XB-GENE-5895036 Length:412 Species:Xenopus tropicalis


Alignment Length:103 Identity:31/103 - (30%)
Similarity:51/103 - (49%) Gaps:13/103 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 SGRSSRDRERMHKSREHPQASRCIGVFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGF 140
            |.|||.|.:|          |..||  .|.....:..||:.|::.|.::.::::.|.:|...:||
 Frog   262 SKRSSHDNKR----------SAFIG--NLPYEIEEEAVRDHFSECGKVQGVRIIRDQKTGIGKGF 314

  Fly   141 CFIYFEKLSDARAAKDSCSGIEVDGRRIRVDFSITQRA 178
            .::.||. :||.......:..|:.||:|||..|:|..|
 Frog   315 GYVLFES-ADAVQLALKLNNSELSGRKIRVKRSLTAEA 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM_TRA2 96..175 CDD:409798 23/78 (29%)
rbm34NP_001004890.1 RRM1_RBM34 168..259 CDD:409828
RRM2_RBM34 272..344 CDD:409829 21/74 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.