DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and nifk

DIOPT Version :10

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001005639.1 Gene:nifk / 448106 XenbaseID:XB-GENE-940532 Length:276 Species:Xenopus tropicalis


Alignment Length:175 Identity:35/175 - (20%)
Similarity:77/175 - (44%) Gaps:21/175 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 RERMHKSREHPQASR----CIGVFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFI 143
            ::::|:.|...|...    .|.:..:.....:.::||.|:::|.:.|:::....:|..|:|:.::
 Frog    23 QQKVHEIRRKSQVGAVSPGVIYIGHIPRALYEPQLREYFSQFGTVTRLRLSRSKKTGNSKGYAYV 87

  Fly   144 YFEKLSDARAAKDSCSGIEVDGRRIRVDFSITQRAHTPTPGVYLG-----RQPRGKAPRSFSPRR 203
            .||....|:...|:.:......|.::.:|...::.|   |.:::|     |:|...|...::.||
 Frog    88 EFECDEVAKIVADTMNNYLFCERLLKCEFVPPEKVH---PRLFIGCTAKFRKPTKPAVSRYNKRR 149

  Fly   204 G---RRVYHDRSASPYDNYRDRYDYRNDRYD------RNLRRSPS 239
            .   ::....|..|..:..|.|...:...||      |..|:.|:
 Frog   150 SEAEQKKMTQRMLSKENKVRKRLAEKGIDYDFPGFAARRERKEPT 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM_TRA2 96..175 CDD:409798 15/82 (18%)
nifkNP_001005639.1 RRM_NIFK_like 42..115 CDD:409748 14/72 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 190..211 2/5 (40%)
hNIFK_binding 200..251 CDD:463489
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 256..276
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.