DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and Rox8

DIOPT Version :10

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_732944.2 Gene:Rox8 / 42848 FlyBaseID:FBgn0005649 Length:470 Species:Drosophila melanogaster


Alignment Length:129 Identity:34/129 - (26%)
Similarity:55/129 - (42%) Gaps:23/129 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 IGVFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSGIEV 163
            |.|..|:.......:||.|..:|.|...::|.|..|.:|:|:.|:.|.|.::|..|..:.:|..:
  Fly    97 IFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWI 161

  Fly   164 DGRRIRVDFSITQRAHTPTPGVYLGRQP---------RGKAPRSFSPRRG------RRVYHDRS 212
            ..|.||.::|..:   .|.|     |:|         .|..|.:.|..:|      ..||:..|
  Fly   162 GSRSIRTNWSTRK---LPPP-----REPSKGGGQGGGMGGGPGNGSGVKGSQRHTFEEVYNQSS 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM_TRA2 96..175 CDD:409798 23/75 (31%)
Rox8NP_732944.2 RRM1_TIA1_like 9..80 CDD:409788
RRM2_TIA1_like 96..170 CDD:409789 22/72 (31%)
RRM_SF 221..292 CDD:473069
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.