DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and CstF64

DIOPT Version :10

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_477453.1 Gene:CstF64 / 42239 FlyBaseID:FBgn0027841 Length:419 Species:Drosophila melanogaster


Alignment Length:118 Identity:29/118 - (24%)
Similarity:63/118 - (53%) Gaps:9/118 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 SRDRERMHKSREHPQASRCIGVFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIY 144
            ::::..|.||      .|.:.|..:....::.|::|:|::.||:..:::|.|.::.:.:||.|..
  Fly     5 AQEQSIMDKS------MRSVFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCE 63

  Fly   145 FEKLSDARAAKDSCSGIEVDGRRIRVDFSITQRAHTPTPGVYLGRQ---PRGK 194
            ::....|.:|..:.:|.|:.||.:|||.:.|:::......:..|.|   |.|:
  Fly    64 YKDQETALSAMRNLNGYEIGGRTLRVDNACTEKSRMEMQQLLQGPQVENPYGE 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM_TRA2 96..175 CDD:409798 21/78 (27%)
CstF64NP_477453.1 RRM_CSTF2_CSTF2T 10..94 CDD:410072 24/89 (27%)
CSTF2_hinge 111..190 CDD:433869 2/6 (33%)
CSTF_C 377..416 CDD:464130
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.