Sequence 1: | NP_476764.1 | Gene: | tra2 / 36619 | FlyBaseID: | FBgn0003742 | Length: | 264 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_998467.1 | Gene: | hnrnpabb / 406594 | ZFINID: | ZDB-GENE-040426-2516 | Length: | 309 | Species: | Danio rerio |
Alignment Length: | 207 | Identity: | 49/207 - (23%) |
---|---|---|---|
Similarity: | 79/207 - (38%) | Gaps: | 39/207 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 71 EPRHRSGRSSRDRERMHKSREHPQASRCIGVFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQ 135
Fly 136 RSRGFCFIYF------EKLSDARAAKDSCSGIEVDGRRIRVDFSITQRAHTPTPGVYLGRQPRGK 194
Fly 195 APRSFSPRRGRRVYHDRS-------------------------ASPYDNYRDRYDYRND---RYD 231
Fly 232 RNLRRSPSRNRY 243 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
tra2 | NP_476764.1 | RRM | <74..242 | CDD:223796 | 48/201 (24%) |
RRM_TRA2 | 98..175 | CDD:240809 | 25/82 (30%) | ||
hnrnpabb | NP_998467.1 | CBFNT | 2..45 | CDD:285369 | |
RRM1_hnRNPAB | 46..120 | CDD:241201 | 3/14 (21%) | ||
RRM_SF | 125..204 | CDD:302621 | 25/83 (30%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |