DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and hnrnpabb

DIOPT Version :9

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_998467.1 Gene:hnrnpabb / 406594 ZFINID:ZDB-GENE-040426-2516 Length:309 Species:Danio rerio


Alignment Length:207 Identity:49/207 - (23%)
Similarity:79/207 - (38%) Gaps:39/207 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 EPRHRSGRSSRDRERMHKSREHPQASRCIGVFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQ 135
            :..||......|.:|....::.|.....:|  |||..|::.|:||.|..:|.||.|::..|.:|.
Zfish   105 QKEHRLDGRQIDPKRAMAIKKEPVKKIFVG--GLNPETTEEKIREYFGSFGEIETIELPTDPKTS 167

  Fly   136 RSRGFCFIYF------EKLSDARAAKDSCSGIEVDGRRIRVDFSITQRAHTPTPGVYLGRQPRGK 194
            :.|||.||.|      :|:.:.:......|..|:   :|.....|.|:......|...|.:.||:
Zfish   168 KRRGFVFITFKEEFAVKKILEKKYHNVCGSKCEI---KIAQPKEIYQQQQFGARGGGFGGRGRGR 229

  Fly   195 APRSFSPRRGRRVYHDRS-------------------------ASPYDNYRDRYDYRND---RYD 231
            .....|..:|...|.::.                         :|.|..|...|||.:.   .|.
Zfish   230 GGPGQSWNQGYNNYWNQGYGGQGYGYGGQQGYGGYGGYGNYDYSSGYYGYGSGYDYTDQGAASYG 294

  Fly   232 RNLRRSPSRNRY 243
            :..||...::.|
Zfish   295 KTPRRGGHQSGY 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM <74..242 CDD:223796 48/201 (24%)
RRM_TRA2 98..175 CDD:240809 25/82 (30%)
hnrnpabbNP_998467.1 CBFNT 2..45 CDD:285369
RRM1_hnRNPAB 46..120 CDD:241201 3/14 (21%)
RRM_SF 125..204 CDD:302621 25/83 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.