DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and tra2b

DIOPT Version :9

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_957491.1 Gene:tra2b / 394172 ZFINID:ZDB-GENE-040426-1094 Length:278 Species:Danio rerio


Alignment Length:269 Identity:119/269 - (44%)
Similarity:152/269 - (56%) Gaps:40/269 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DREPLSSGRLHCSARYKHKR--SASSSSAGTTSSGHKDRRSDYDYCGSRRHQRSSSRRRSRSRS- 63
            :|.|     .|...|..|.|  |.|.|.:.|.|..|:..|..|....||.:.|   |||||||| 
Zfish    34 ERSP-----AHSKERSHHSRSKSRSRSRSKTRSRSHRSSRRHYSRSRSRSYSR---RRRSRSRSY 90

  Fly    64 SSESPPPEPRHRSGRSSRDRERMHKSREH------PQASRCIGVFGLNTNTSQHKVRELFNKYGP 122
            |||      .||. |||.....|...|.|      |..:.|:|||||:..|::..:||:|:||||
Zfish    91 SSE------YHRR-RSSHSHSPMSNRRRHIGDRANPDPNCCLGVFGLSLYTTERDLREVFSKYGP 148

  Fly   123 IERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSGIEVDGRRIRVDFSITQRAHTPTPGVYL 187
            :..:.:|.|.|::|||||..:|||...|::.||:..:|:|:||||||||:|||:..||||||:|:
Zfish   149 LSDVCIVYDQQSRRSRGFALVYFENREDSKEAKERANGMELDGRRIRVDYSITKGPHTPTPGIYM 213

  Fly   188 GRQPRGKAPRSFSPRRGRRVYHDRS-ASPYDNYRDRYDYRNDRYDRNLRRSP----SRNRYTRNR 247
            ||...|..| |.|.||..   :||. ...||:|.|| ||.|:|     ||||    ||..| |:|
Zfish   214 GRPTYGGGP-SVSRRRDS---YDRGYERGYDSYEDR-DYHNNR-----RRSPSPYYSRGPY-RSR 267

  Fly   248 SYSRSRSPQ 256
            |.|||.||:
Zfish   268 SRSRSYSPR 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM <74..242 CDD:223796 82/178 (46%)
RRM_TRA2 98..175 CDD:240809 39/76 (51%)
tra2bNP_957491.1 RRM_TRA2B 114..202 CDD:241085 41/87 (47%)
RRM <118..>199 CDD:223796 39/80 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I8460
eggNOG 1 0.900 - - E33208_3BKR9
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H137664
Inparanoid 1 1.050 178 1.000 Inparanoid score I4021
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001901
OrthoInspector 1 1.000 - - otm24231
orthoMCL 1 0.900 - - OOG6_103481
Panther 1 1.100 - - O PTHR48034
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1765
SonicParanoid 1 1.000 - - X1620
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.850

Return to query results.
Submit another query.