DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and lark

DIOPT Version :10

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster


Alignment Length:211 Identity:62/211 - (29%)
Similarity:82/211 - (38%) Gaps:56/211 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 KSREHPQA-SRCIGVFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDA 151
            |||..|.. :..|.|..|...|...:|||||.|||.:....:|        |.:.|::.:.:.|.
  Fly    76 KSRRAPNTPTTKIFVGNLTDKTRAPEVRELFQKYGTVVECDIV--------RNYGFVHLDCVGDV 132

  Fly   152 RAAKDSCSGIEVDGRRIRVDFSITQRAHTPTPGV-------YLGRQPR--GKAPRSFSPRRGRRV 207
            :.|....:|..|||:.::|..| |.|.. |.||:       ..||...  .:.||.:....|.|.
  Fly   133 QDAIKELNGRVVDGQPLKVQVS-TSRVR-PKPGMGDPEQCYRCGRSGHWSKECPRLYGSAGGGRE 195

  Fly   208 ---------YHDR--SASPY---------------DNYRDRYDYRNDRYDRNLRRSPSRNRYTRN 246
                     |.||  ...||               |.:|| |||    |||  |...||:.|.|.
  Fly   196 PPSPLSAGGYRDRMYGRDPYPPPPPPPPFLRDRIMDGFRD-YDY----YDR--RFEDSRDLYERR 253

  Fly   247 RSYSRSRS---PQLRR 259
            ...||.|.   |.:.|
  Fly   254 YQTSRMRDFPPPPISR 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM_TRA2 96..175 CDD:409798 23/78 (29%)
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779
RRM1_2_CoAA_like 87..152 CDD:409779 21/72 (29%)
hnRNP-R-Q <88..>258 CDD:273732 53/186 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.