DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and hnrnpa1b

DIOPT Version :9

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_956398.1 Gene:hnrnpa1b / 378453 ZFINID:ZDB-GENE-030912-14 Length:422 Species:Danio rerio


Alignment Length:148 Identity:35/148 - (23%)
Similarity:64/148 - (43%) Gaps:28/148 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 SRRHQRSSSRRRSRSRSSSESPPPEPRHRSGRSSRDRERMHKSREHPQASRCIGVFGLNTNTSQH 111
            |.|.....:|.....|.|.|..|.||           |::.|          :.:.||:..|:..
Zfish     4 SHRQACGVARTEIVGRMSKEGQPREP-----------EQLRK----------LFIGGLSFETTDD 47

  Fly   112 KVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSGIEVDGRRIRVDFSITQ 176
            .:|..|.::|.:....::.|..|:|||||.|:.:..:.:..|:.|: ...:||||.:....::::
Zfish    48 SLRAHFEQWGTLTDCVVMKDPNTKRSRGFGFVTYSSVDEVNASMDA-RPHKVDGRLVEPKRAVSR 111

  Fly   177 R------AHTPTPGVYLG 188
            .      |||....:::|
Zfish   112 EDSSKPFAHTTVKKIFVG 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM <74..242 CDD:223796 26/121 (21%)
RRM_TRA2 98..175 CDD:240809 20/76 (26%)
hnrnpa1bNP_956398.1 RRM <19..187 CDD:223796 32/133 (24%)
RRM_SF 31..111 CDD:302621 21/90 (23%)
RRM2_hnRNPA1 124..200 CDD:241024 1/6 (17%)
HnRNPA1 367..>387 CDD:288479
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.