DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and TBPH

DIOPT Version :9

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001163280.1 Gene:TBPH / 37781 FlyBaseID:FBgn0025790 Length:531 Species:Drosophila melanogaster


Alignment Length:274 Identity:55/274 - (20%)
Similarity:97/274 - (35%) Gaps:73/274 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 CGSR-RHQRSSSRRRSRSRSSSESPPPE-------------PRHRSGRSSRDRER-MHKSREHPQ 94
            ||.: |:..:.:.|..||......||..             |:....:|..:.|. ..|::....
  Fly    38 CGLKYRNLDTKAVRGVRSNEGRLFPPSVESGWGEYAYFCVFPKENKRKSDDNLENSTAKTKRIET 102

  Fly    95 ASRC--IGVFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDS 157
            ..||  :.|.||...|::..:||.|..||.:...|:..|.::.:|:||.|:.|... ||:....:
  Fly   103 RLRCTDLIVLGLPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSY-DAQMRVLT 166

  Fly   158 CSGIEVDGR--RIRVDFSITQRAHTPTPGVYLGR--------------QPRGKAPRSFSPR---- 202
            ...: :|||  .::|..|.......|.. |::||              ...|:....|.||    
  Fly   167 NRHL-IDGRWCEVKVPNSKGMGHQVPCK-VFVGRCTEDINSDDLREYFSKFGEVTDVFIPRPFRA 229

  Fly   203 ----------------------RGRRVYHDRSASPYDNYRDR----YDYR-------NDRYDRNL 234
                                  :|..|:...:|...:..|::    |:|.       :..:.:..
  Fly   230 FSFVTFLDPDVAQSLCGEDHIIKGVSVHVSNAAPKAEQNRNQQVQSYNYNSANSFGMHSYHPQGN 294

  Fly   235 RRSPSRNRYTRNRS 248
            ..:|.||.:.|..:
  Fly   295 HMNPGRNGHHRGNN 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM <74..242 CDD:223796 44/223 (20%)
RRM_TRA2 98..175 CDD:240809 24/80 (30%)
TBPHNP_001163280.1 RRM1_TDP43 108..184 CDD:240767 22/77 (29%)
RRM2_TDP43 192..261 CDD:240768 9/69 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.