DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and Sxl

DIOPT Version :9

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster


Alignment Length:109 Identity:27/109 - (24%)
Similarity:47/109 - (43%) Gaps:17/109 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 PQASRCIGVFGLNTN---------TSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKL 148
            |:||        |||         .:..::..||...|||...:::.|.:|..|.|:.|:.|...
  Fly   112 PRAS--------NTNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSE 168

  Fly   149 SDARAAKDSCSGIEVDGRRIRVDFSITQRAHTPTPGVYLGRQPR 192
            .|::.|....:||.|..:|::|.::...........:|:...||
  Fly   169 MDSQRAIKVLNGITVRNKRLKVSYARPGGESIKDTNLYVTNLPR 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM <74..242 CDD:223796 27/109 (25%)
RRM_TRA2 98..175 CDD:240809 21/85 (25%)
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 20/79 (25%)
RRM2_Hu_like 203..281 CDD:240822 3/10 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.