DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and Ref2

DIOPT Version :10

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_609574.1 Gene:Ref2 / 34667 FlyBaseID:FBgn0032439 Length:220 Species:Drosophila melanogaster


Alignment Length:224 Identity:45/224 - (20%)
Similarity:82/224 - (36%) Gaps:63/224 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 GSRRHQRSSSRRRSRSRSSSESPPPEPRHRSGRSSRDRERMHKSREHPQASRCIGVFGLNTNTSQ 110
            ||.|.:.|....|...||         |:.:|...:.:.:.....:.|:....:.|..|:.....
  Fly    33 GSIRKRNSEGGLRGIQRS---------RNGTGFIRKSKFKQETLLKPPKKPTLVMVCNLDYGVDD 88

  Fly   111 HKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSGIEVDGRRIRVDFSIT 175
            ..:.||||:.|.:|:..:..| :...|.|...:.|:...:|....:...|:.:||||::      
  Fly    89 DDIMELFNQDGVVEKGFVHYD-RDGNSLGTAHLSFKYREEAFQIIEQFHGVRLDGRRLK------ 146

  Fly   176 QRAHTPTPGVYLGRQPRGKAPRSFSPRRGRRVYHDRSASPYDNYRDRYDYRNDRYDRNLRRSPSR 240
                     ::|.:..|                         |::     |.|..|.:||....:
  Fly   147 ---------LHLVQNTR-------------------------NFK-----RTDVDDLSLRMGSFK 172

  Fly   241 NRYTRNRSYSRSRSPQ-------LRRTSS 262
            .|:.:|.:: ::||.|       |.|.||
  Fly   173 TRFLQNGTF-KTRSLQNGFQKSRLFRNSS 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM_TRA2 96..175 CDD:409798 18/78 (23%)
Ref2NP_609574.1 RRM_SF 75..149 CDD:473069 18/89 (20%)

Return to query results.
Submit another query.