DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and Rsf1

DIOPT Version :10

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_477001.2 Gene:Rsf1 / 34370 FlyBaseID:FBgn0011305 Length:200 Species:Drosophila melanogaster


Alignment Length:149 Identity:40/149 - (26%)
Similarity:57/149 - (38%) Gaps:49/149 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 FNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSGIEVDGRRIRVDFSITQRAHTP 181
            |.|||.:..:.:..:..     ||.|:.||...||..|.|..:|.|:.|.::||:.|        
  Fly    30 FTKYGKLNSVWIAFNPP-----GFAFVEFEHRDDAEKACDILNGSELLGSQLRVEIS-------- 81

  Fly   182 TPGVYLGRQPRGKAPRSFSPRRGRRVYHDRSASPYDNYRDRYDYRNDRYD-----------RNLR 235
                      :|:      ||:|||      ..|.|....|.|:  .|:.           |...
  Fly    82 ----------KGR------PRQGRR------GGPMDRGGRRGDF--GRHSITSGGSGGGGFRQRG 122

  Fly   236 RSPSRNRYTRNRSYSRSRS 254
            .|.|.:|:| .|.||..||
  Fly   123 SSGSSSRHT-ERGYSSGRS 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM_TRA2 96..175 CDD:409798 19/57 (33%)
Rsf1NP_477001.2 RRM_SRSF3_like 11..82 CDD:409808 19/74 (26%)

Return to query results.
Submit another query.