DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and safb

DIOPT Version :9

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_999848.1 Gene:safb / 321979 ZFINID:ZDB-GENE-030131-698 Length:855 Species:Danio rerio


Alignment Length:299 Identity:66/299 - (22%)
Similarity:107/299 - (35%) Gaps:85/299 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SASSSSAGTTSSGHKDRRSDYD-----------YCGSRRHQRSSSRRRS--------RSRSSSES 67
            ||.:.:|..|  |.:|..|..|           .|.|.....||..:.|        :|.....|
Zfish   307 SAQADNASET--GLRDIESAVDSEMASKGEAVEECKSTDPAESSEVKESSVQGDDQKKSEEEDAS 369

  Fly    68 PPPEPRHRSGRSSRDRERMHKSREHPQASRCIGVFGLNTNTSQHKVRELFNKYGPIERIQMVIDA 132
            ..||.:...|.:|              :.|.:.|.||::.|....::.||:|||.:...::|.:|
Zfish   370 TKPESKDDKGGAS--------------SGRNLWVSGLSSTTRATDLKNLFSKYGKVVGAKVVTNA 420

  Fly   133 QTQRSRGFCFIYFEKLSDARAAKDSCSGIEVDGRRIRVDFSITQRAHTPTPGVYLGRQPRGK--A 195
            ::..:|.:.|:....:.:|..........|:.||.|.|:.:..:.|         |::|..|  |
Zfish   421 RSPGARCYGFVTMCSIEEATKCISHLHRTELHGRMISVERAKNEPA---------GKKPADKNDA 476

  Fly   196 PRSFSPRR------------------------GRRVYHDRS-ASPYDNYRDRYDYRNDR-YDRNL 234
            .:|.|.||                        .|.|..|:| ..|..:.:.:...|:.: .||| 
Zfish   477 KKSVSDRRLSSDSKTDKSENKDEKTEGDGKGGERTVVMDKSKGEPVISLKTKSKERSSKSRDRN- 540

  Fly   235 RRSPSRNR----------YTRNRSYSRSRSPQLRRTSSR 263
              |.|:.|          ..|.|...|.|..::|....|
Zfish   541 --SLSKERKDILSFDQIKEQRERERQRQREREIREVERR 577

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM <74..242 CDD:223796 42/195 (22%)
RRM_TRA2 98..175 CDD:240809 19/76 (25%)
safbNP_999848.1 SAP 19..53 CDD:128789
RRM_SAFB1_SAFB2 384..459 CDD:241123 19/74 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1765
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.