DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and Rbmxl1

DIOPT Version :10

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001100890.1 Gene:Rbmxl1 / 307779 RGDID:1306751 Length:388 Species:Rattus norvegicus


Alignment Length:161 Identity:51/161 - (31%)
Similarity:73/161 - (45%) Gaps:13/161 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 GLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSGIEVDGRR 167
            ||||.|::..:..:|.|||.|..|.::.|.:|.:||||.|:.||..:||:......:|..:||:.
  Rat    14 GLNTETNEKALEAVFGKYGRIVEILLMKDRETNKSRGFAFVTFESPADAKDVARDMNGKSLDGKA 78

  Fly   168 IRVDFSITQRAHTPTPGVYLGRQPRGKAPRSFSPRRGRRVYHDRSASPYDNYRDRYDYRND-RYD 231
            |:|:       ....|....||:.....|||..|.||.|.....:..|    ..|..|.:| .|.
  Rat    79 IKVE-------QATKPSFESGRRGPPPPPRSRGPPRGLRGGSGGTRGP----PSRGGYMDDGGYS 132

  Fly   232 RNLRRSPSRNRYTRNRS-YSRSRSPQLRRTS 261
            .|...|.||......|. ..||..|..:|::
  Rat   133 MNFNMSSSRGPLPVKRGPPPRSGGPPPKRST 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM_TRA2 96..175 CDD:409798 27/71 (38%)
Rbmxl1NP_001100890.1 RRM_RBMX_like 7..86 CDD:409816 27/78 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 61..388 31/114 (27%)
dnaA 162..>303 CDD:455861 0/2 (0%)
RBM1CTR 170..214 CDD:400429
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.