DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and Rbmx

DIOPT Version :10

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001020834.1 Gene:Rbmx / 302855 RGDID:1565256 Length:390 Species:Rattus norvegicus


Alignment Length:159 Identity:48/159 - (30%)
Similarity:68/159 - (42%) Gaps:32/159 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 GLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSGIEVDGRR 167
            ||||.|::..:..:|.|||.|..:.::.|.:|.:||||.|:.||..:||:.|....:|..:||:.
  Rat    14 GLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMNGKSLDGKA 78

  Fly   168 IRVDFSITQRAHTPTPGVYLGRQPRGKAPRSFSPRRGRRVYHDRSASPYDNYRDRYDYRNDRYDR 232
            |:|:       ....|....||:.....|||..|.||.|.....|.                   
  Rat    79 IKVE-------QATKPSFESGRRGLPPPPRSRGPPRGLRGGRGGSG------------------- 117

  Fly   233 NLRRSPSR------NRYTRNRSYSRSRSP 255
            ..|..|||      ..|:.|.:.|.||.|
  Rat   118 GTRGPPSRGGHMDDGGYSMNFTLSSSRGP 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM_TRA2 96..175 CDD:409798 27/71 (38%)
RbmxNP_001020834.1 RRM_RBMX_like 7..86 CDD:409816 27/78 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 58..390 29/115 (25%)
dnaA 165..>302 CDD:455861
RBM1CTR 173..217 CDD:400429
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.