DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and TRA2A

DIOPT Version :9

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_037425.1 Gene:TRA2A / 29896 HGNCID:16645 Length:282 Species:Homo sapiens


Alignment Length:256 Identity:112/256 - (43%)
Similarity:148/256 - (57%) Gaps:28/256 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ARYKHKRSASSSSAGTTSSGHKDRRSDYDYCGSRRHQRSSSRRRSRSRSSSESPPPEPRHRSGRS 79
            :::....|.|.|.:.:.|..|..||    |..||.|.. |.||||||||.:    ||.|.|..||
Human    43 SKHSESHSRSRSKSRSRSRRHSHRR----YTRSRSHSH-SHRRRSRSRSYT----PEYRRRRSRS 98

  Fly    80 ---SRDRERMHKSREHPQASRCIGVFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFC 141
               ..:|.|...||.:|..:.|:|||||:..|::..:||:|::|||:..:.:|.|.:|.|||||.
Human    99 HSPMSNRRRHTGSRANPDPNTCLGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFA 163

  Fly   142 FIYFEKLSDARAAKDSCSGIEVDGRRIRVDFSITQRAHTPTPGVYLGRQPR-------GKAPRSF 199
            |:|||::.|::.|.:..:|:|:||||||||:|||:||||||||:|:||...       |......
Human   164 FVYFERIDDSKEAMERANGMELDGRRIRVDYSITKRAHTPTPGIYMGRPTHSGGGGGGGGGGGGG 228

  Fly   200 SPRRGRRVYHDRSAS-PYDNYRDRYDYRNDRYDRNLRRSPSRNRYTRNRSYSRSRSPQLRR 259
            ...|.|..|:||... .||.|.| |||      |..||||| ..|:|.||.|||||...||
Human   229 GGGRRRDSYYDRGYDRGYDRYED-YDY------RYRRRSPS-PYYSRYRSRSRSRSYSPRR 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM <74..242 CDD:223796 78/178 (44%)
RRM_TRA2 98..175 CDD:240809 38/76 (50%)
TRA2ANP_037425.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..118 31/83 (37%)
RRM_TRA2 118..197 CDD:409798 38/78 (49%)
Linker 198..225 12/26 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..245 15/43 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..282 14/23 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152360
Domainoid 1 1.000 85 1.000 Domainoid score I8169
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 176 1.000 Inparanoid score I4049
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001901
OrthoInspector 1 1.000 - - otm41356
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR48034
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1765
SonicParanoid 1 1.000 - - X1620
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.980

Return to query results.
Submit another query.