DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and RBMX

DIOPT Version :10

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_002130.2 Gene:RBMX / 27316 HGNCID:9910 Length:391 Species:Homo sapiens


Alignment Length:159 Identity:48/159 - (30%)
Similarity:68/159 - (42%) Gaps:32/159 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 GLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSGIEVDGRR 167
            ||||.|::..:..:|.|||.|..:.::.|.:|.:||||.|:.||..:||:.|....:|..:||:.
Human    14 GLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMNGKSLDGKA 78

  Fly   168 IRVDFSITQRAHTPTPGVYLGRQPRGKAPRSFSPRRGRRVYHDRSASPYDNYRDRYDYRNDRYDR 232
            |:|:       ....|....||:.....|||..|.||.|.....|.                   
Human    79 IKVE-------QATKPSFESGRRGPPPPPRSRGPPRGLRGGRGGSG------------------- 117

  Fly   233 NLRRSPSR------NRYTRNRSYSRSRSP 255
            ..|..|||      ..|:.|.:.|.||.|
Human   118 GTRGPPSRGGHMDDGGYSMNFNMSSSRGP 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM_TRA2 96..175 CDD:409798 27/71 (38%)
RBMXNP_002130.2 RRM_RBMX_like 7..86 CDD:409816 27/78 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 61..391 29/112 (26%)
dnaA 165..>306 CDD:455861
RBM1CTR 173..217 CDD:400429
Necessary for the association to nascent RNAPII transcripts and nuclear localization 186..236
Necessary for RNA-binding 333..391
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.