DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and Ncl

DIOPT Version :9

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_036881.2 Gene:Ncl / 25135 RGDID:3153 Length:714 Species:Rattus norvegicus


Alignment Length:145 Identity:38/145 - (26%)
Similarity:65/145 - (44%) Gaps:38/145 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 RSSSESPPPEPRHRSGRSSRDRERMHKSREHPQASRCIGVFGLNTNTSQHKVRELFNKYGPIERI 126
            |...:.|...|..||                 |.|:.:.|.||:.:|::..::|.|.  |.: |.
  Rat   558 RLELQGPRGSPNARS-----------------QPSKTLFVKGLSEDTTEETLKESFE--GSV-RA 602

  Fly   127 QMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSGIEVDGRRIRVDFSITQRAHTPTPGVYLGRQP 191
            ::|.|.:|..|:||.|:.|....||:|||::....|:||.::.:|::                :|
  Rat   603 RIVTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLDWA----------------KP 651

  Fly   192 RGKAPRSFSPRRGRR 206
            :|:.  .|..|.|.|
  Rat   652 KGEG--GFGGRGGGR 664

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM <74..242 CDD:223796 35/133 (26%)
RRM_TRA2 98..175 CDD:240809 25/76 (33%)
NclNP_036881.2 8 X 8 AA tandem repeats of X-T-P-X-K-K-X-X 58..135
RRM1_NCL 312..386 CDD:240849
RRM2_NCL 395..470 CDD:240850
RRM3_NCL 489..561 CDD:240851 1/2 (50%)
RRM4_NCL 576..653 CDD:240852 26/95 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 646..714 7/37 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48034
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.