DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and Tardbp

DIOPT Version :10

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_663531.1 Gene:Tardbp / 230908 MGIID:2387629 Length:414 Species:Mus musculus


Alignment Length:115 Identity:27/115 - (23%)
Similarity:48/115 - (41%) Gaps:29/115 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 VFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSGIEVDG 165
            |.||...|::..:::.|:.:|.:..:|:..|.:|..|:||.|:.|.:..         :.::|..
Mouse   108 VLGLPWKTTEQDLKDYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYE---------TQVKVMS 163

  Fly   166 RRIRVDFSITQRAHTPTPGVYLGRQPRGKAPRS----FSPRRGRRVYHDR 211
            :|..:|                ||....|.|.|    ..|.|.|:|:..|
Mouse   164 QRHMID----------------GRWCDCKLPNSKQSPDEPLRSRKVFVGR 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM_TRA2 96..175 CDD:409798 17/73 (23%)
TardbpNP_663531.1 TDP43_N 4..77 CDD:465833
RRM1_TDP43 105..178 CDD:409760 20/94 (21%)
RRM2_TDP43 191..261 CDD:409761 3/7 (43%)
Interaction with UBQLN2. /evidence=ECO:0000250|UniProtKB:Q13148 216..414
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 261..301
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 341..414
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.