DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and HNRNPA3

DIOPT Version :9

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001317178.1 Gene:HNRNPA3 / 220988 HGNCID:24941 Length:378 Species:Homo sapiens


Alignment Length:122 Identity:41/122 - (33%)
Similarity:66/122 - (54%) Gaps:6/122 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 PPPEPRHRSGRSSRDR-ERMHKSREHPQASRCIGVFGLNTNTSQHKVRELFNKYGPIERIQMVID 131
            ||..|:..|||..|.| |..|..:| |:..|.:.:.||:..|:...:||.|.|:|.:....::.|
Human     6 PPGRPQPDSGRRRRRRGEEGHDPKE-PEQLRKLFIGGLSFETTDDSLREHFEKWGTLTDCVVMRD 69

  Fly   132 AQTQRSRGFCFIYFEKLSDARAAKDSCS-GIEVDGRRIRVDFSITQRAHTPTPGVYL 187
            .||:|||||.|:.:..:.:..||  .|: ..:||||.:....::: |..:..||.:|
Human    70 PQTKRSRGFGFVTYSCVEEVDAA--MCARPHKVDGRVVEPKRAVS-REDSVKPGAHL 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM <74..242 CDD:223796 38/116 (33%)
RRM_TRA2 98..175 CDD:240809 24/77 (31%)
HNRNPA3NP_001317178.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35 12/29 (41%)
RRM1_hnRNPA_like 36..113 CDD:409992 24/79 (30%)
RRM2_hnRNPA3 126..205 CDD:409996
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..225
HnRNPA1 331..>347 CDD:402981
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 336..378
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.