DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and Tia1

DIOPT Version :10

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_035715.1 Gene:Tia1 / 21841 MGIID:107914 Length:386 Species:Mus musculus


Alignment Length:75 Identity:19/75 - (25%)
Similarity:45/75 - (60%) Gaps:2/75 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 VFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSGIEVDG 165
            |..|:.:.::..:.:||::.||.:..:|::|  |..:..:||:.|.:...|.||..:.:|.::.|
Mouse    11 VGNLSRDVTEALILQLFSQIGPCKNCKMIMD--TAGNDPYCFVEFHEHRHAAAALAAMNGRKIMG 73

  Fly   166 RRIRVDFSIT 175
            :.::|:::.|
Mouse    74 KEVKVNWATT 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM_TRA2 96..175 CDD:409798 18/73 (25%)
Tia1NP_035715.1 RRM1_TIA1 8..81 CDD:410027 18/71 (25%)
RRM2_TIA1 104..181 CDD:410030
RRM3_TIAR 214..286 CDD:241064
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 355..376
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.