DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and Rbm3

DIOPT Version :9

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001159881.1 Gene:Rbm3 / 19652 MGIID:1099460 Length:154 Species:Mus musculus


Alignment Length:145 Identity:53/145 - (36%)
Similarity:70/145 - (48%) Gaps:22/145 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 VFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSGIEVDG 165
            |.|||.||.:..:.:.|:.:|||..:.:|.|.:|||||||.||.|.....|..|..:.:|..:||
Mouse    10 VGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASDAMRAMNGESLDG 74

  Fly   166 RRIRVDFSITQRAHTPTPGVYLGR---QPRGKAPRSFSPRR------------GR-RVYHDRSAS 214
            |:||||.: .:.|.....|.:.||   ..||...:.:...|            || |.|..||..
Mouse    75 RQIRVDHA-GKSARGSRGGAFGGRGRSYSRGGGDQGYGSGRYDSRPGGYGYGYGRSRDYSGRSQG 138

  Fly   215 PYD-----NYRDRYD 224
            .||     ||||.||
Mouse   139 GYDRYSGGNYRDNYD 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM <74..242 CDD:223796 53/145 (37%)
RRM_TRA2 98..175 CDD:240809 32/73 (44%)
Rbm3NP_001159881.1 RRM_CIRBP_RBM3 6..85 CDD:240895 32/75 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48034
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.