DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and T07F10.3

DIOPT Version :9

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_506222.2 Gene:T07F10.3 / 179765 WormBaseID:WBGene00011589 Length:371 Species:Caenorhabditis elegans


Alignment Length:269 Identity:52/269 - (19%)
Similarity:93/269 - (34%) Gaps:71/269 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 QRSSSRRRSRSRSSSE--------------SPPP-----EPRHRSGRSSRDRERMHKSREHPQAS 96
            :..||..||.|.:|.|              .|.|     ||...|..|.:....:..|..:.|.:
 Worm     5 EEHSSPTRSTSSNSDEPTETIESGDQFDVNEPIPTIETLEPVIISAASVQQLPAISLSGNNAQRT 69

  Fly    97 RCIGVFGLNTNTSQHKVRELFNKYG----PIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDS 157
            ..||  .:.|:.::..:.::|.:.|    .::|:.:     ....:|:|||.|....:||.....
 Worm    70 LWIG--DVPTDWTEETLSQVFTECGHAPYKVKRVYV-----KDELKGYCFIEFITFDEARQTLYD 127

  Fly   158 CSGIEVDG-RRIRVDFSITQRAHTPTP--GVYLGRQPRGKAPR-------SFSPRRGRRVYH--D 210
            .:|..:.| :.||.:......::.|..  .:::...|...|..       .:...||.:::.  |
 Worm   128 LNGNRIPGFKDIRFNLCFANDSYNPNSEFNLHVSSVPDDMADAELYRIFDKYQSCRGAKMFRFVD 192

  Fly   211 RSA--SPYDNYRDRYDY------------------------RNDRYDRNLRRSPSRNRYTRNRSY 249
            .|:  |.:..:.::.|.                        |.:|.||...|.....|..|.|. 
 Worm   193 GSSKGSGFVRFGNQTDQQMALVEMHRTKVGGCRIILKLAGSRGERLDRGESRQFKSQRNDRRRD- 256

  Fly   250 SRSRSPQLR 258
              .:|.|.|
 Worm   257 --EKSGQYR 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM <74..242 CDD:223796 35/209 (17%)
RRM_TRA2 98..175 CDD:240809 17/81 (21%)
T07F10.3NP_506222.2 RRM1_SECp43_like 69..149 CDD:240790 17/86 (20%)
RRM_SF 155..234 CDD:302621 8/78 (10%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.