DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment tra2 and Ncl

DIOPT Version :9

Sequence 1:	NP_476764.1	Gene:	tra2 / 36619	FlyBaseID:	FBgn0003742	Length:	264	Species:	Drosophila melanogaster
Sequence 2:	NP_035010.3	Gene:	Ncl / 17975	MGIID:	97286	Length:	707	Species:	Mus musculus

Alignment Length:	130	Identity:	38/130 - (29%)
Similarity:	66/130 - (50%)	Gaps:	23/130 - (17%)

- Green bases have known domain annotations that are detailed below.

  Fly    77 GRSSRDRERMHKSREHPQASRCIGVFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFC 141
            ||:.|...:...||..|  |:.:.|.||:.:|::..::|.|.  |.: |.::|.|.:|..|:||.
Mouse   551 GRTIRLELQGSNSRSQP--SKTLFVKGLSEDTTEETLKESFE--GSV-RARIVTDRETGSSKGFG 610

  Fly   142 FIYFEKLSDARAAKDSCSGIEVDGRRIRVDFSITQRAHTPTPGVYLGRQPRGKAPRSFSPRRGRR 206
            |:.|....||:|||::....|:||.::.:|::                :|:|:.  .|..|.|.|
Mouse   611 FVDFNSEEDAKAAKEAMEDGEIDGNKVTLDWA----------------KPKGEG--GFGGRGGGR 657

Fly 207 206
Mouse 658 657

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
tra2	NP_476764.1	RRM	<74..242	CDD:223796	38/130 (29%)
tra2	NP_476764.1	RRM_TRA2	98..175	CDD:240809	25/76 (33%)
Ncl	NP_035010.3	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..308
		8 X 8 AA tandem repeats of X-T-P-X-K-K-X-X	58..135
		RRM1_NCL	309..383	CDD:240849
		RRM2_NCL	392..467	CDD:240850
		RRM3_NCL	486..558	CDD:240851	3/6 (50%)
		RRM4_NCL	569..646	CDD:240852	26/95 (27%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	639..707		7/37 (19%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR48034
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	2.010