DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and sqd-1

DIOPT Version :10

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001380080.1 Gene:sqd-1 / 177392 WormBaseID:WBGene00022235 Length:308 Species:Caenorhabditis elegans


Alignment Length:157 Identity:38/157 - (24%)
Similarity:64/157 - (40%) Gaps:32/157 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 KSREHPQASRCIGVFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDAR 152
            ||||:.:    :.|.||.::.|:..:|..|.::|.::.|:...|.||:..|.|.||.||:  :..
 Worm   105 KSRENKK----VFVGGLPSDYSEQDLRSHFEQFGKVDDIEWPFDKQTKARRNFAFIVFEE--EES 163

  Fly   153 AAKDSCSGIEVDG-RRIRVDFSITQRAHTPTP--------GVY-----------------LGRQP 191
            |.|.|....:..| |...|..::.|....|..        |:|                 :|..|
 Worm   164 ADKASSQTKQTFGTRECDVKKAVPQGKRFPGAQGRMPGGRGMYGGRGGNNNSGWYAGWGQIGAMP 228

  Fly   192 RGKAPRSFSPRRGRRVYHDRSASPYDN 218
            .|....::....|...|..:.|:.::|
 Worm   229 YGATGAAWGDWYGNGYYGQQGAAHHNN 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM_TRA2 96..175 CDD:409798 23/79 (29%)
sqd-1NP_001380080.1 RRM2_NsCP33_like 30..104 CDD:410187
RRM_SF 111..185 CDD:473069 23/79 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.