DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and rnp-7

DIOPT Version :10

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_498565.2 Gene:rnp-7 / 176002 WormBaseID:WBGene00004390 Length:332 Species:Caenorhabditis elegans


Alignment Length:190 Identity:53/190 - (27%)
Similarity:86/190 - (45%) Gaps:47/190 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 EHPQAS----RCIGVFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDA 151
            |:|:||    |.:.|..:|..||:.|:|..|..||.|:::.||.| :..:.||:.||.:...::.
 Worm    94 ENPRASEDPYRTLFVGRINYETSESKLRREFEAYGKIKKLTMVHD-EAGKPRGYAFIEYSDKAEM 157

  Fly   152 RAAKDSCSGIEVDGRRIRVDFSITQRAHTPTPGVYLGRQPRGKAPRSFSPRR------------- 203
            ..|.....||:|||:|:.||:.                  ||:..:::.|||             
 Worm   158 HTAYKKADGIKVDGKRLVVDYE------------------RGRTQKTWLPRRLGGGKGDTRKTRE 204

  Fly   204 GRRVYHDRSASPYDNYRDRYDYRNDRYDRNLRRSPSRNRYTRNRSY-SRSRSPQLRRTSS 262
            .:.|..:|..:  ..:...|:      ||:..||.||:|  |..|| :...:.:.||.||
 Worm   205 AKSVIEEREIA--SGFGGGYE------DRDRERSGSRDR--RQDSYRNGGGNDRDRRESS 254

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM_TRA2 96..175 CDD:409798 28/82 (34%)