DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and eif-3.G

DIOPT Version :10

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001263666.1 Gene:eif-3.G / 174346 WormBaseID:WBGene00001230 Length:262 Species:Caenorhabditis elegans


Alignment Length:92 Identity:24/92 - (26%)
Similarity:44/92 - (47%) Gaps:3/92 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 DRERMHKSREHPQASRCIGVFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFE 146
            |..::.::|......|   |..|....::.::|:||.|.|.:.||.:..|..|...:||.|:.||
 Worm   170 DGRQIDRNRSDENTCR---VTNLPQEMNEDELRDLFGKIGRVIRIFIARDKVTGLPKGFAFVTFE 231

  Fly   147 KLSDARAAKDSCSGIEVDGRRIRVDFS 173
            ...||..|....:.|.:....::|:::
 Worm   232 SRDDAARAIAELNDIRMYHMVLKVEWT 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM_TRA2 96..175 CDD:409798 22/78 (28%)
eif-3.GNP_001263666.1 eIF3G 33..143 CDD:240597
RRM_eIF3G_like 183..257 CDD:409842 22/76 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.