DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and CSTF2

DIOPT Version :10

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001293135.1 Gene:CSTF2 / 1478 HGNCID:2484 Length:597 Species:Homo sapiens


Alignment Length:114 Identity:26/114 - (22%)
Similarity:56/114 - (49%) Gaps:10/114 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 RCIGVFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSGI 161
            |.:.|..:....::.:::::|::.||:...::|.|.:|.:.:|:.|..::....|.:|..:.:|.
Human    16 RSVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGR 80

  Fly   162 EVDGRRIRVDFSITQRAHTPTPGVYLG----RQPRGK------APRSFS 200
            |..||.:|||.:.:::.......:..|    ..|.|:      ||.|.|
Human    81 EFSGRALRVDNAASEKNKEELKSLGTGAPVIESPYGETISPEDAPESIS 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM_TRA2 96..175 CDD:409798 19/77 (25%)
CSTF2NP_001293135.1 PABP-1234 4..352 CDD:130689 26/114 (23%)
RRM_CSTF2_CSTF2T 10..94 CDD:410072 19/77 (25%)
CSTF2_hinge 112..191 CDD:433869 6/18 (33%)
PHA03378 <253..455 CDD:223065
CSTF_C 553..593 CDD:464130
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.