DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and HNRNPA1L2

DIOPT Version :10

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001011724.1 Gene:HNRNPA1L2 / 144983 HGNCID:27067 Length:320 Species:Homo sapiens


Alignment Length:143 Identity:37/143 - (25%)
Similarity:59/143 - (41%) Gaps:37/143 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 EPRHRSGRSSRDRERMHKSREHPQASRCIGVFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQ 135
            ||:....|....|...|.:      .:.|.|.|:..:|.:|.:|:.|.:||.||.|:::.|..:.
Human    85 EPKRAVSREDSQRPGAHLT------VKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSG 143

  Fly   136 RSRGFCFIYFEKLSDARAAKDSCSGIEVDGRRIRVDFSITQRAHTPTPGVYLGRQ-------PRG 193
            :.|||.|:.|:.       .||            ||..:.|:.||     ..|..       |:.
Human   144 KKRGFAFVTFDD-------HDS------------VDKIVIQKYHT-----VKGHNCEVRKALPKQ 184

  Fly   194 KAPRSFSPRRGRR 206
            :...:.|.:||||
Human   185 EMASASSSQRGRR 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM_TRA2 96..175 CDD:409798 22/78 (28%)
HNRNPA1L2NP_001011724.1 Globular A domain 4..94 3/8 (38%)
RRM1_hnRNPA1 12..92 CDD:410154 2/6 (33%)
Globular B domain 95..185 29/119 (24%)
RRM_SF 105..184 CDD:473069 27/102 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 181..216 6/17 (35%)
RNA-binding RGG-box 218..240
HnRNPA1 255..292 CDD:463312
Nuclear targeting sequence. /evidence=ECO:0000250 268..305
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 271..320
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.