DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and Srsf10

DIOPT Version :10

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001073856.1 Gene:Srsf10 / 14105 MGIID:1333805 Length:262 Species:Mus musculus


Alignment Length:190 Identity:58/190 - (30%)
Similarity:85/190 - (44%) Gaps:56/190 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 NTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSGIE---VDGRRI 168
            :|....:|..|.:||||..:.:.:|..|:|.|||.::.||   |.|.|:|:...::   :.||:|
Mouse    20 DTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFE---DVRDAEDALHNLDRKWICGRQI 81

  Fly   169 RVDFSITQRAHTPTPGVYLGRQPRGKAPRSFSPRRGRRVYHDRSASPYDNYRDRY------DY-- 225
            .:.|:...|                |.|.....:.||.||   |:|.||:| |||      .|  
Mouse    82 EIQFAQGDR----------------KTPNQMKAKEGRNVY---SSSRYDDY-DRYRRSRSRSYER 126

  Fly   226 ---RNDRYDRNLRR--SPSRNRYT-----------------RNRSYSRSRSPQLRRTSSR 263
               |:..:|.|.||  ||..:|.|                 ||||:|||:|....|:.|:
Mouse   127 RRSRSRSFDYNYRRSYSPRNSRPTGRPRRSRSHSDNDRFKHRNRSFSRSKSNSRSRSKSQ 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM_TRA2 96..175 CDD:409798 23/70 (33%)
Srsf10NP_001073856.1 RRM_SF 5..99 CDD:473069 26/97 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..262 21/71 (30%)

Return to query results.
Submit another query.