DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and SC35

DIOPT Version :10

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:XP_061513963.1 Gene:SC35 / 1279150 VectorBaseID:AGAMI1_006283 Length:167 Species:Anopheles gambiae


Alignment Length:177 Identity:55/177 - (31%)
Similarity:77/177 - (43%) Gaps:37/177 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 SREHPQASRCIG--VFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDA 151
            :|..|:....|.  |..|...|:...:|.:|.:.|.:..|.:..|..|:.||||.|:.|....||
Mosquito     5 ARPPPRIDGMISLKVDNLTYRTTPDDLRRVFERCGEVGDIYIPRDRHTRESRGFAFVRFYDKRDA 69

  Fly   152 RAAKDSCSGIEVDGRRIRVDFSITQRAHTPTPGVYLGRQPRGKAPRSFSPRRGRRVYHDRSASPY 216
            ..|.|:..|..:|||.:||.               :.|..|..:|:    |||.| |:.|.    
Mosquito    70 EDALDAMDGRMLDGRELRVQ---------------MARYGRPTSPQ----RRGNR-YNGRE---- 110

  Fly   217 DNYRDRYDYRNDRYDRNLRRSPSRNRYTRNRSYSR--SRSPQLRRTS 261
                     |....:|:.|||.||:...|.|||||  ||:|:.|..|
Mosquito   111 ---------RGRSRERHRRRSRSRSPEHRRRSYSRSKSRTPRSRSGS 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM_TRA2 96..175 CDD:409798 26/80 (33%)
SC35XP_061513963.1 None

Return to query results.
Submit another query.