DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and Hnrnpd

DIOPT Version :9

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001070733.1 Gene:Hnrnpd / 11991 MGIID:101947 Length:355 Species:Mus musculus


Alignment Length:277 Identity:62/277 - (22%)
Similarity:108/277 - (38%) Gaps:48/277 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 HCSARYKHKRSASSS-----------SAGTTSSGHKDRRSDYDYCGSRRHQRSSSRRRSR----- 60
            |.::..:|..:|::.           |..||....||..|.:........:......|||     
Mouse    79 HSNSSPRHTEAAAAQREEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFV 143

  Fly    61 ---SRSSSESPPPEPRHRSGRSSRDRERMHKSREHPQASRCIGVFGLNTNTSQHKVRELFNKYGP 122
               ...|.:....:..|:......|.:|. |:.:..:..:.|.|.||:.:|.:.|:||.|..:|.
Mouse   144 LFKESESVDKVMDQKEHKLNGKVIDPKRA-KAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGE 207

  Fly   123 IERIQMVIDAQTQRSRGFCFIYF------EKLSDARAAKDSCSGIEVDGRRIRVDFSITQRAHTP 181
            :|.|::.:|.:|.:.||||||.|      :|:.:.:......|..|:.....:..:.  |:....
Mouse   208 VESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQ--QQQQWG 270

  Fly   182 TPGVYLGR-QPRGKAP-----RSFS------------PRRGRRVYHDRSASPYDNYRDRYDYRND 228
            :.|.:.|| :.||..|     :.:|            ..:|...|.....:.|:||....||.|.
Mouse   271 SRGGFAGRARGRGGGPSQNWNQGYSNYWNQGYGNYGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQ 335

  Fly   229 R--YDRNLRRSPSRNRY 243
            :  |.:..||...:|.|
Mouse   336 QSGYGKVSRRGGHQNSY 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM <74..242 CDD:223796 47/193 (24%)
RRM_TRA2 98..175 CDD:240809 24/82 (29%)
HnrnpdNP_001070733.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..91 2/11 (18%)
CBFNT <60..78 CDD:311868
RRM1_hnRNPD_like 99..172 CDD:241019 12/72 (17%)
RRM2_hnRNPD 183..257 CDD:241027 24/73 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.