DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and Rbm3

DIOPT Version :9

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_446148.1 Gene:Rbm3 / 114488 RGDID:620145 Length:156 Species:Rattus norvegicus


Alignment Length:148 Identity:52/148 - (35%)
Similarity:70/148 - (47%) Gaps:26/148 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 VFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSGIEVDG 165
            |.|||.||.:..:.:.|:.:|||..:.:|.|.:|||||||.||.|.....|..|..:.:|..:||
  Rat    10 VGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASDAMRAMNGESLDG 74

  Fly   166 RRIRVDFSITQRAHTPTPGVYLGRQPRGKA------------------PRSFSPRRGR-RVYHDR 211
            |:||||.:  .::...|.|...|...||::                  |..:....|| |.|..|
  Rat    75 RQIRVDHA--GKSARGTRGGAFGAHGRGRSYSRGGGDQGYGSGRYDSRPGGYGYGYGRSRDYSGR 137

  Fly   212 SASPYD-----NYRDRYD 224
            |...||     ||||.||
  Rat   138 SQGGYDRYSGGNYRDNYD 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM <74..242 CDD:223796 52/148 (35%)
RRM_TRA2 98..175 CDD:240809 32/73 (44%)
Rbm3NP_446148.1 RRM_CIRBP_RBM3 6..85 CDD:409883 32/76 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48034
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.