DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and SRSF8

DIOPT Version :10

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_115285.1 Gene:SRSF8 / 10929 HGNCID:16988 Length:282 Species:Homo sapiens


Alignment Length:177 Identity:64/177 - (36%)
Similarity:85/177 - (48%) Gaps:17/177 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 VFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSGIEVDG 165
            |..|...||...:|.:|.|||.:..:.:..:..|:..|||.|:.|....||:.|:.:..|.|:||
Human    18 VDNLTYRTSPDSLRRVFEKYGRVGDVYIPREPHTKAPRGFAFVRFHDRRDAQDAEAAMDGAELDG 82

  Fly   166 RRIRVDFSITQRAHTP----------TPGVYLGRQPRGKAPRSFSPRRGRRVYHDRSASP-YDNY 219
            |.:||..:...|...|          :.|...||:.|....||.||||..|   .||..| ....
Human    83 RELRVQVARYGRRDLPRSRQGEPRGRSRGGGYGRRSRSYGRRSRSPRRRHR---SRSRGPSCSRS 144

  Fly   220 RDRYDYRNDRYDRN-LRRSP-SRNRYTRNRSYSRSRSPQLRRTSSRY 264
            |.|..||..||.|: ..||| ||:||:|: .|||||..:.|...|.|
Human   145 RSRSRYRGSRYSRSPYSRSPYSRSRYSRS-PYSRSRYRESRYGGSHY 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM_TRA2 96..175 CDD:409798 25/73 (34%)
SRSF8NP_115285.1 RRM_SRSF2_SRSF8 16..88 CDD:409751 24/69 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..282 39/104 (38%)

Return to query results.
Submit another query.