DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and SRSF10

DIOPT Version :9

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_473357.1 Gene:SRSF10 / 10772 HGNCID:16713 Length:262 Species:Homo sapiens


Alignment Length:190 Identity:58/190 - (30%)
Similarity:85/190 - (44%) Gaps:56/190 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 NTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSGIE---VDGRRI 168
            :|....:|..|.:||||..:.:.:|..|:|.|||.::.||   |.|.|:|:...::   :.||:|
Human    20 DTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFE---DVRDAEDALHNLDRKWICGRQI 81

  Fly   169 RVDFSITQRAHTPTPGVYLGRQPRGKAPRSFSPRRGRRVYHDRSASPYDNYRDRY------DY-- 225
            .:.|:...|                |.|.....:.||.||   |:|.||:| |||      .|  
Human    82 EIQFAQGDR----------------KTPNQMKAKEGRNVY---SSSRYDDY-DRYRRSRSRSYER 126

  Fly   226 ---RNDRYDRNLRR--SPSRNRYT-----------------RNRSYSRSRSPQLRRTSSR 263
               |:..:|.|.||  ||..:|.|                 ||||:|||:|....|:.|:
Human   127 RRSRSRSFDYNYRRSYSPRNSRPTGRPRRSRSHSDNDRFKHRNRSFSRSKSNSRSRSKSQ 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM <74..242 CDD:223796 46/150 (31%)
RRM_TRA2 98..175 CDD:240809 23/70 (33%)
SRSF10NP_473357.1 RRM_SF 5..99 CDD:418427 26/97 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..262 21/71 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.