DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tra2 and zcrb1

DIOPT Version :9

Sequence 1:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001107973.1 Gene:zcrb1 / 100135752 XenbaseID:XB-GENE-999756 Length:215 Species:Xenopus tropicalis


Alignment Length:200 Identity:36/200 - (18%)
Similarity:81/200 - (40%) Gaps:60/200 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 TNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSGI---EVDGRR 167
            ||...|::   |:|||.:.::.::.|..::||:|..|:.|   .|..::::...|:   ::.||.
 Frog    22 TNNDLHRI---FSKYGKVVKVTILKDKDSRRSKGVAFVLF---LDKESSQNCVRGLNNKQLFGRA 80

  Fly   168 IRVDFS---------ITQRAHTPTPGVY----------------LG-RQPRGKAPRSFSPRRGRR 206
            |:...:         |.:|.:|.....|                || |:|    |:....::.::
 Frog    81 IKASIAIDNGRATEFIRRRNYTDKSRCYECGDTGHLSYACPKNMLGEREP----PQKKEKKKRKK 141

  Fly   207 VY----------HDRSASP-YDNYRDRYDYRNDRYDRNLRRSPSRNRYTRNRSYSR----SRSPQ 256
            :.          .|....| .|:......::..|.:.      .:|:|..:.:.:.    ||.|:
 Frog   142 IVEAEVFEEDESEDEGEDPALDSLSQAIAFQQARIEE------EKNKYRHDAAEASTSEDSRRPR 200

  Fly   257 LRRTS 261
            :::::
 Frog   201 IKKST 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tra2NP_476764.1 RRM <74..242 CDD:223796 31/175 (18%)
RRM_TRA2 98..175 CDD:240809 18/80 (23%)
zcrb1NP_001107973.1 RRM_ZCRB1 9..86 CDD:240839 18/69 (26%)
PTZ00368 <97..123 CDD:173561 3/25 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.